Lineage for d3zdsl_ (3zds L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424649Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2424650Protein automated matches [190388] (31 species)
    not a true protein
  7. 2424755Species Pseudomonas putida [TaxId:160488] [196877] (3 PDB entries)
  8. 2424767Domain d3zdsl_: 3zds L: [218270]
    automated match to d4aq6a_
    complexed with fe, hmq, hq9, m8o, omd, oxy, po4

Details for d3zdsl_

PDB Entry: 3zds (more details), 1.7 Å

PDB Description: structure of homogentisate 1,2-dioxygenase in complex with reaction intermediates of homogentisate with oxygen.
PDB Compounds: (L:) homogentisate 1,2-dioxygenase

SCOPe Domain Sequences for d3zdsl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zdsl_ b.82.1.0 (L:) automated matches {Pseudomonas putida [TaxId: 160488]}
dlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyri
rpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpa
gvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrv
elldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflg
ehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgma
nmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsah
gpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpst
fnpnrr

SCOPe Domain Coordinates for d3zdsl_:

Click to download the PDB-style file with coordinates for d3zdsl_.
(The format of our PDB-style files is described here.)

Timeline for d3zdsl_: