Lineage for d3vzyb_ (3vzy B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828233Protein PcrB protein homolog YerE [102046] (2 species)
    provisional classification; it is not known whether this protein binds FMN or not
  7. 2828234Species Bacillus subtilis [TaxId:1423] [102047] (5 PDB entries)
  8. 2828238Domain d3vzyb_: 3vzy B: [218175]
    automated match to d3vzza_
    complexed with 1gp, cl, mg

Details for d3vzyb_

PDB Entry: 3vzy (more details), 1.63 Å

PDB Description: Crystal structure of PcrB complexed with G1P from bacillus subtilis subap. subtilis str. 168
PDB Compounds: (B:) Heptaprenylglyceryl phosphate synthase

SCOPe Domain Sequences for d3vzyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vzyb_ c.1.4.1 (B:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]}
mydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrflv
pcvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegyci
anpdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavlet
stlfygggikdaetakqyaehadvivvgnavyedfdralktvaavkge

SCOPe Domain Coordinates for d3vzyb_:

Click to download the PDB-style file with coordinates for d3vzyb_.
(The format of our PDB-style files is described here.)

Timeline for d3vzyb_: