Lineage for d3vzpa_ (3vzp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846723Species Cupriavidus necator [TaxId:381666] [224880] (4 PDB entries)
  8. 2846724Domain d3vzpa_: 3vzp A: [218160]
    Other proteins in same PDB: d3vzpb2, d3vzpd2
    automated match to d3ennd_
    complexed with dio, gol, so4

Details for d3vzpa_

PDB Entry: 3vzp (more details), 1.79 Å

PDB Description: crystal structure of phab from ralstonia eutropha
PDB Compounds: (A:) Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d3vzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vzpa_ c.2.1.0 (A:) automated matches {Cupriavidus necator [TaxId: 381666]}
tqriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfiasegn
vadwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslfnvtk
qvidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevatkgvtvntv
spgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadfslng
glhmg

SCOPe Domain Coordinates for d3vzpa_:

Click to download the PDB-style file with coordinates for d3vzpa_.
(The format of our PDB-style files is described here.)

Timeline for d3vzpa_: