Lineage for d3vzoa_ (3vzo A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1534192Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 1534237Protein Xylanase II [49979] (18 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 1534260Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)
  8. 1534268Domain d3vzoa_: 3vzo A: [218159]
    automated match to d3vzlb_
    complexed with so4; mutant

Details for d3vzoa_

PDB Entry: 3vzo (more details), 1.73 Å

PDB Description: crystal structure of the bacillus circulans endo-beta-(1,4)-xylanase (bcx) n35h mutant with glu78 covalently bonded to 2-deoxy-2-fluoro- xylobiose
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3vzoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vzoa_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntghfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOPe Domain Coordinates for d3vzoa_:

Click to download the PDB-style file with coordinates for d3vzoa_.
(The format of our PDB-style files is described here.)

Timeline for d3vzoa_: