Lineage for d3vyra_ (3vyr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2791216Superfamily b.40.14: HupF/HypC-like [159127] (1 family) (S)
    contains extra C-terminal helix packed against the beta-barrel side
    automatically mapped to Pfam PF01455
  5. 2791217Family b.40.14.1: HupF/HypC-like [159128] (1 protein)
    Pfam PF01455
  6. 2791218Protein Hydrogenase expression/formation protein HypC [159129] (3 species)
  7. 2791224Species Thermococcus kodakaraensis [TaxId:311400] [159132] (5 PDB entries)
    Uniprot Q5JII0 2-72
  8. 2791229Domain d3vyra_: 3vyr A: [218151]
    automated match to d2z1cc_
    complexed with cit, sf4

Details for d3vyra_

PDB Entry: 3vyr (more details), 2.55 Å

PDB Description: Crystal structure of the HypC-HypD complex
PDB Compounds: (A:) Hydrogenase expression/formation protein HypC

SCOPe Domain Sequences for d3vyra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vyra_ b.40.14.1 (A:) Hydrogenase expression/formation protein HypC {Thermococcus kodakaraensis [TaxId: 311400]}
avpgkvievngpvavvdfggvkrevrldlmpdtkpgdwvivhtgfaiekldekkameile
awaevekamegf

SCOPe Domain Coordinates for d3vyra_:

Click to download the PDB-style file with coordinates for d3vyra_.
(The format of our PDB-style files is described here.)

Timeline for d3vyra_: