SCOPe 2.07: Domain d3vvhc1: 3vvh C:62-381

Lineage for d3vvhc1 (3vvh C:62-381)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Dual specificity mitogen-activated protein kinase kinase 1, Mek1 [118137] (2 species)
   OPK group (?); MAPKK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118138] (42 PDB entries)
   Uniprot Q02750 61-381

8. Domain d3vvhc1: 3vvh C:62-381 [218121]
   Other proteins in same PDB: d3vvha2, d3vvhb2, d3vvhc2
   automated match to d1s9ja_
   complexed with 4bm, atp, mg

Details for d3vvhc1

PDB Entry: 3vvh, 2 Å

PDB Description: X-ray structure of the human mitogen-activated protein kinase kinase 1 (MEK1) in complex with an inhibitor and MgATP

PDB Compounds: (C:) Dual specificity mitogen-activated protein kinase kinase 1

SCOPe Domain Sequences for d3vvhc1:

Sequence, based on SEQRES records:

>d3vvhc1 d.144.1.7 (C:62-381) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]}
elkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhec
nspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltylr
ekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthys
vqsdiwsmglslvemavgrypipppdakelelmfgcqvegdaaetpprprtpgrplssyg
mdsrppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhafi
krsdaeevdfagwlcstigl

Sequence, based on observed residues (ATOM records):

>d3vvhc1 d.144.1.7 (C:62-381) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]}
elkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhec
nspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltylr
ekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthys
vqsdiwsmglslvemavgrypipppdapmaifelldyivnepppklpsgvfslefqdfvn
kcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigl

Timeline for d3vvhc1:

• d3vvhc1 first appeared in SCOPe 2.03, called d3vvhc_
  
• d3vvhc1 appears in SCOPe 2.06
  
• d3vvhc1 appears in the current release, SCOPe 2.08