Lineage for d1c7sa1 (1c7s A:781-885)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1299506Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1299513Protein Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain [49211] (1 species)
    rudiment form of Ig-like domain; follows the catalytic (beta/alpha)8-barrel domain; family 20 glycosyl hydrolases
  7. 1299514Species Serratia marcescens [TaxId:615] [49212] (4 PDB entries)
  8. 1299516Domain d1c7sa1: 1c7s A:781-885 [21812]
    Other proteins in same PDB: d1c7sa2, d1c7sa3, d1c7sa4
    complexed with cbs, so4; mutant

Details for d1c7sa1

PDB Entry: 1c7s (more details), 1.8 Å

PDB Description: beta-n-acetylhexosaminidase mutant d539a complexed with di-n-acetyl- beta-d-glucosamine (chitobiase)
PDB Compounds: (A:) beta-n-acetylhexosaminidase

SCOPe Domain Sequences for d1c7sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7sa1 b.1.18.2 (A:781-885) Bacterial chitobiase (N-acetyl-beta-glucoseaminidase), C-terminal domain {Serratia marcescens [TaxId: 615]}
gethfvdtqalekdwlrfanilgqrelakldkggvayrlpvpgarvaggkleanialpgl
gieystdggkqwqrydakakpavsgevqvrsvspdgkrysraekv

SCOPe Domain Coordinates for d1c7sa1:

Click to download the PDB-style file with coordinates for d1c7sa1.
(The format of our PDB-style files is described here.)

Timeline for d1c7sa1: