Lineage for d3vs5b1 (3vs5 B:86-146)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392687Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 2392688Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries)
  8. 2392726Domain d3vs5b1: 3vs5 B:86-146 [218091]
    Other proteins in same PDB: d3vs5a2, d3vs5a3, d3vs5a4, d3vs5b2, d3vs5b3, d3vs5b4
    automated match to d1qcfa1
    complexed with ca, vsg

Details for d3vs5b1

PDB Entry: 3vs5 (more details), 2.85 Å

PDB Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 7-(1-methylpiperidin-4-yl)-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vs5b1 b.34.2.1 (B:86-146) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t

SCOPe Domain Coordinates for d3vs5b1:

Click to download the PDB-style file with coordinates for d3vs5b1.
(The format of our PDB-style files is described here.)

Timeline for d3vs5b1: