Lineage for d3vs4b2 (3vs4 B:147-249)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2572086Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 2572087Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries)
  8. 2572112Domain d3vs4b2: 3vs4 B:147-249 [218086]
    Other proteins in same PDB: d3vs4a1, d3vs4a3, d3vs4a4, d3vs4b1, d3vs4b3, d3vs4b4
    automated match to d1qcfa2
    complexed with ca, cl, vsf

Details for d3vs4b2

PDB Entry: 3vs4 (more details), 2.75 Å

PDB Description: Crystal structure of HCK complexed with a pyrrolo-pyrimidine inhibitor 5-(4-phenoxyphenyl)-7-(tetrahydro-2H-pyran-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vs4b2 d.93.1.1 (B:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d3vs4b2:

Click to download the PDB-style file with coordinates for d3vs4b2.
(The format of our PDB-style files is described here.)

Timeline for d3vs4b2: