SCOPe 2.04: Domain d3vpqa1: 3vpq A:2-76

Lineage for d3vpqa1 (3vpq A:2-76)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (133 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [226183] (8 PDB entries)

8. Domain d3vpqa1: 3vpq A:2-76 [218011]
   Other proteins in same PDB: d3vpqa2
   automated match to d1m0ua2
   complexed with 1pe, gsh, peg, pgo

Details for d3vpqa1

PDB Entry: 3vpq, 1.7 Å

PDB Description: Crystal structure of Bombyx mori sigma-class glutathione transferase in complex with glutathione

PDB Compounds: (A:) Glutathione S-transferase sigma

SCOPe Domain Sequences for d3vpqa1:

Sequence; same for both SEQRES and ATOM records:

>d3vpqa1 c.47.1.0 (A:2-76) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
pnvkfyyfpvkalgesqrlllayggqefednrissenwpefkpktpfgqmpvleidgkqy
aqstaicrylgrkyg

Timeline for d3vpqa1:

• d3vpqa1 first appeared in SCOPe 2.03
  
• d3vpqa1 appears in SCOPe 2.05
  
• d3vpqa1 appears in the current release, SCOPe 2.08