| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein Cell-division protein FtsZ [55309] (9 species) |
| Species Staphylococcus aureus [TaxId:158878] [226456] (6 PDB entries) |
| Domain d3vpaa2: 3vpa A:209-315 [217972] Other proteins in same PDB: d3vpaa1, d3vpab1, d3vpac1, d3vpad1, d3vpad3 automated match to d1rq2a2 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 3vpa (more details), 2.49 Å
SCOPe Domain Sequences for d3vpaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpaa2 d.79.2.1 (A:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf
Timeline for d3vpaa2: