SCOPe 2.08: Domain d3vo2a2: 3vo2 A:155-314

Lineage for d3vo2a2 (3vo2 A:155-314)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [226538] (17 PDB entries)

8. Domain d3vo2a2: 3vo2 A:155-314 [217950]
   Other proteins in same PDB: d3vo2a1, d3vo2b1
   automated match to d1frna2
   complexed with fad

Details for d3vo2a2

PDB Entry: 3vo2, 1.39 Å

PDB Description: Crystal structure of Zea mays leaf ferredoxin-NADP+ reductase III

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3vo2a2:

Sequence; same for both SEQRES and ATOM records:

>d3vo2a2 c.25.1.0 (A:155-314) automated matches {Maize (Zea mays) [TaxId: 4577]}
mlmpkdpnatvimlatgtgiapfrsflwkmfleehedykfsglawlflgvptsdsllyke
elekmkemapdnfrldfavsreqtnaagekmyiqtrmaeyreelwellkkdntyvymcgl
kgmekgiddimlnlaakdgidwmqykkqlkkgeqwnvevy

Timeline for d3vo2a2:

• d3vo2a2 first appeared in SCOPe 2.03
  
• d3vo2a2 appears in SCOPe 2.07