SCOPe 2.08: Domain d3vo2b1: 3vo2 B:19-159

Lineage for d3vo2b1 (3vo2 B:19-159)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein automated matches [227029] (5 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [225854] (1 PDB entry)

8. Domain d3vo2b1: 3vo2 B:19-159 [217951]
   Other proteins in same PDB: d3vo2a1, d3vo2a2, d3vo2b2
   automated match to d1qfza1
   complexed with fad

Details for d3vo2b1

PDB Entry: 3vo2, 1.39 Å

PDB Description: Crystal structure of Zea mays leaf ferredoxin-NADP+ reductase III

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3vo2b1:

Sequence; same for both SEQRES and ATOM records:

>d3vo2b1 b.43.4.2 (B:19-159) automated matches {Maize (Zea mays) [TaxId: 4577]}
tskkqdeglvtnkykpkepyvgrclsntritgddapgetwhmvfstegeipyregqsigi
iadgedkngkphklrlysiassalgdfgdsktvslcvkrlvytndqgeivkgvcsnflcd
lkpgadvkitgpvgkemlmpk

Timeline for d3vo2b1:

• d3vo2b1 first appeared in SCOPe 2.03
  
• d3vo2b1 appears in SCOPe 2.07