SCOPe 2.03: Domain d3vl7a_: 3vl7 A:

Lineage for d3vl7a_ (3vl7 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (18 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:211586] [194175] (8 PDB entries)

8. Domain d3vl7a_: 3vl7 A: [217911]
   automated match to d3vl3a_
   complexed with ca, cl, ipm

Details for d3vl7a_

PDB Entry: 3vl7, 2.2 Å

PDB Description: 3-isopropylmalate dehydrogenase from shewanella oneidensis mr-1 at 650 mpa

PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d3vl7a_:

Sequence; same for both SEQRES and ATOM records:

>d3vl7a_ c.77.1.1 (A:) automated matches {Shewanella oneidensis [TaxId: 211586]}
ssyqiavlagdgigpevmaearkvlkavearfglnieyteydvggiaidnhgcplpeatl
kgceaadailfgsvggpkweklppneqpergallplrghfelfcnlrpaklhdglehmsp
lrsdisargfdvlcvreltggiyfgkpkgrqgegeseeafdtmrysrreisriariafea
argrrkkvtsvdkanvlacsvlwrqvveevavdfpdvelehiyidnatmqllrrpdefdv
mlcsnlfgdilsdeiamltgsmgllssasmnstgfglfepaggsapdiagkgianpiaqi
lsaalmlrhslkqeeaasaieravtkalnsgyltgellssdqrhkakttvqmgdfiadav
kagv

Timeline for d3vl7a_:

• d3vl7a_ is new in SCOPe 2.03-stable
  
• d3vl7a_ appears in SCOPe 2.04
  
• d3vl7a_ appears in the current release, SCOPe 2.08, called d3vl7a1