| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (17 species) |
| Species Lactobacillus casei [TaxId:1582] [51865] (6 PDB entries) |
| Domain d3vkvf1: 3vkv F:7-150 [217903] Other proteins in same PDB: d3vkva2, d3vkvb2, d3vkvc2, d3vkvd2, d3vkve2, d3vkvf2 automated match to d1llca1 complexed with fbp, so4 |
PDB Entry: 3vkv (more details), 2.7 Å
SCOPe Domain Sequences for d3vkvf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vkvf1 c.2.1.5 (F:7-150) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
kdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkki
ysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaan
pvdiltyatwklsgfpknrvvgsg
Timeline for d3vkvf1: