Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries) Uniprot O75015 23-189 |
Domain d1e4ja1: 1e4j A:2-86 [21785] |
PDB Entry: 1e4j (more details), 2.5 Å
SCOPe Domain Sequences for d1e4ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4ja1 b.1.1.4 (A:2-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} lpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatvn dsgeyrcqtnlstlsdpvqlevhig
Timeline for d1e4ja1: