Lineage for d1fnla2 (1fnl A:87-175)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518665Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1518714Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 1518723Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)
    Uniprot O75015 23-189
  8. 1518725Domain d1fnla2: 1fnl A:87-175 [21784]
    complexed with hg

Details for d1fnla2

PDB Entry: 1fnl (more details), 1.8 Å

PDB Description: crystal structure of the extracellular domain of a human fcgriii
PDB Compounds: (A:) low affinity immunoglobulin gamma fc region receptor III-b

SCOPe Domain Sequences for d1fnla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl
kdsgsyfcrglvgsknvssetvnititqa

SCOPe Domain Coordinates for d1fnla2:

Click to download the PDB-style file with coordinates for d1fnla2.
(The format of our PDB-style files is described here.)

Timeline for d1fnla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fnla1