Lineage for d3vi5a2 (3vi5 A:76-199)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326548Protein Class sigma GST [81351] (5 species)
  7. 2326561Species Human (Homo sapiens) [TaxId:9606] [89061] (15 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 2326580Domain d3vi5a2: 3vi5 A:76-199 [217829]
    Other proteins in same PDB: d3vi5a1, d3vi5b1, d3vi5c1, d3vi5d1
    automated match to d1iyha1
    complexed with ca, gol, gsh, m4m

Details for d3vi5a2

PDB Entry: 3vi5 (more details), 2 Å

PDB Description: Human hematopoietic prostaglandin D synthase inhibitor complex structures
PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d3vi5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vi5a2 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d3vi5a2:

Click to download the PDB-style file with coordinates for d3vi5a2.
(The format of our PDB-style files is described here.)

Timeline for d3vi5a2: