Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (57 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:406556] [226690] (2 PDB entries) |
Domain d3vfla_: 3vfl A: [217799] automated match to d3lerc_ complexed with gol, k, mes |
PDB Entry: 3vfl (more details), 1.91 Å
SCOPe Domain Sequences for d3vfla_:
Sequence, based on SEQRES records: (download)
>d3vfla_ c.1.10.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 406556]} syqdlkeckiitafitpfhedgsinfdaipaliehllahhtdgillagttaesptlthde elelfaavqkvvngrvpliagvgtndtrdsiefvkevaefggfaaglaivpyynkpsqeg myqhfkaiadasdlpiiiynipgrvvveltpetmlrladhpniigvkectslanmaylie hkpeefliytgedgdafhamnlgadgvisvashtngdemhemftaiaesdmkkaaaiqrk fipkvnalfsypspapvkailnymgfeagptrlplvpapeedvkriikvvvdgdyeatka tvtgvlrpdy
>d3vfla_ c.1.10.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 406556]} syqdlkeckiitafitpfhedgsinfdaipaliehllahhtdgillagttaesptlthde elelfaavqkvvngrvpliagvgtndtrdsiefvkevaefggfaaglaivpyynkpsqeg myqhfkaiadasdlpiiiynipgrvvveltpetmlrladhpniigvkectslanmaylie hkpeefliytgedgdafhamnlgadgvisvashtngdemhemftaiaesdmkkaaaiqrk fipkvnalfsypspapvkailnymgfeagptrlplvpapeedvkriikvvvdgdyeattv tgvlrpdy
Timeline for d3vfla_: