| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (52 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224896] (58 PDB entries) |
| Domain d3veva2: 3vev A:219-458 [217789] Other proteins in same PDB: d3veva3 automated match to d1bdga2 complexed with 0h4, glc, na |
PDB Entry: 3vev (more details), 1.8 Å
SCOPe Domain Sequences for d3veva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3veva2 c.55.1.0 (A:219-458) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs
edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack
Timeline for d3veva2: