SCOPe 2.08: Domain d3vd0b1: 3vd0 B:115-312

Lineage for d3vd0b1 (3vd0 B:115-312)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)

8. Domain d3vd0b1: 3vd0 B:115-312 [217770]
   Other proteins in same PDB: d3vd0a2, d3vd0b2, d3vd0c2, d3vd0d2, d3vd0i2, d3vd0j2, d3vd0k2, d3vd0l2
   automated match to d3vd1k_
   protein/DNA complex; complexed with zn

Details for d3vd0b1

PDB Entry: 3vd0, 2.95 Å

PDB Description: structure of p73 DNA binding domain tetramer modulates p73 transactivation

PDB Compounds: (B:) Tumor protein p73

SCOPe Domain Sequences for d3vd0b1:

Sequence; same for both SEQRES and ATOM records:

>d3vd0b1 b.2.5.2 (B:115-312) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgta
irampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgrq
svvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegri
cacpgrdrkadedhyreq

Timeline for d3vd0b1:

• d3vd0b1 first appeared in SCOPe 2.03, called d3vd0b_
  
• d3vd0b1 appears in SCOPe 2.07