![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
![]() | Protein automated matches [190198] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries) |
![]() | Domain d3vd0c1: 3vd0 C:115-312 [217771] Other proteins in same PDB: d3vd0a2, d3vd0b2, d3vd0c2, d3vd0d2, d3vd0i2, d3vd0j2, d3vd0k2, d3vd0l2 automated match to d3vd1k_ protein/DNA complex; complexed with zn |
PDB Entry: 3vd0 (more details), 2.95 Å
SCOPe Domain Sequences for d3vd0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vd0c1 b.2.5.2 (C:115-312) automated matches {Human (Homo sapiens) [TaxId: 9606]} ipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgta irampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgrq svvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegri cacpgrdrkadedhyreq
Timeline for d3vd0c1: