Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (32 proteins) |
Protein Ligand binding domain of trkB receptor [49192] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49193] (2 PDB entries) |
Domain d1wwbx_: 1wwb X: [21777] swapped N-terminal strand dimer |
PDB Entry: 1wwb (more details), 2.1 Å
SCOP Domain Sequences for d1wwbx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens)} vhfaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey hgclqldnpthmnngdytliakneygkdekqisahfmgwpgid
Timeline for d1wwbx_: