Lineage for d1wwbx_ (1wwb X:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454877Protein Ligand binding domain of trkB receptor [49192] (1 species)
  7. 454878Species Human (Homo sapiens) [TaxId:9606] [49193] (2 PDB entries)
  8. 454879Domain d1wwbx_: 1wwb X: [21777]
    swapped N-terminal strand dimer

Details for d1wwbx_

PDB Entry: 1wwb (more details), 2.1 Å

PDB Description: ligand binding domain of human trkb receptor

SCOP Domain Sequences for d1wwbx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens)}
vhfaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
hgclqldnpthmnngdytliakneygkdekqisahfmgwpgid

SCOP Domain Coordinates for d1wwbx_:

Click to download the PDB-style file with coordinates for d1wwbx_.
(The format of our PDB-style files is described here.)

Timeline for d1wwbx_: