Lineage for d1wwbx_ (1wwb X:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753846Protein Ligand binding domain of trkB receptor [49192] (1 species)
  7. 2753847Species Human (Homo sapiens) [TaxId:9606] [49193] (2 PDB entries)
  8. 2753848Domain d1wwbx_: 1wwb X: [21777]
    swapped N-terminal strand dimer

Details for d1wwbx_

PDB Entry: 1wwb (more details), 2.1 Å

PDB Description: ligand binding domain of human trkb receptor
PDB Compounds: (X:) PROTEIN (Brain Derived Neurotrophic Factor Receptor TrkB)

SCOPe Domain Sequences for d1wwbx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]}
vhfaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
hgclqldnpthmnngdytliakneygkdekqisahfmgwpgid

SCOPe Domain Coordinates for d1wwbx_:

Click to download the PDB-style file with coordinates for d1wwbx_.
(The format of our PDB-style files is described here.)

Timeline for d1wwbx_: