Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.4: I set domains [49159] (25 proteins) |
Protein Second domain of the Flt-1 receptor [49188] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49189] (4 PDB entries) |
Domain d1qsza_: 1qsz A: [21772] |
PDB Entry: 1qsz (more details)
SCOP Domain Sequences for d1qsza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsza_ b.1.1.4 (A:) Second domain of the Flt-1 receptor {Human (Homo sapiens)} sdtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwds rkgfiisnatykeiglltceatvnghlyktnylthrqtnti
Timeline for d1qsza_: