Lineage for d1qsza_ (1qsz A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.4: I set domains [49159] (25 proteins) Protein Second domain of the Flt-1 receptor [49188] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49189] (4 PDB entries) 
Domain d1qsza_: 1qsz A: [21772]
Details for d1qsza_
PDB Entry: 1qsz (more details)
PDB Description: the vegf-binding domain of flt-1 (minimized mean)
SCOP Domain Sequences for d1qsza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qsza_ b.1.1.4 (A:) Second domain of the Flt-1 receptor {Human (Homo sapiens)}
sdtgrpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwds
rkgfiisnatykeiglltceatvnghlyktnylthrqtnti
SCOP Domain Coordinates for d1qsza_:
Click to download the PDB-style file with coordinates for d1qsza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qsza_:
- d1qsza_ first appeared (with stable ids) in SCOP 1.55
- d1qsza_ appears in SCOP 1.59
- d1qsza_ appears in SCOP 1.63
- d1qsza_ appears in the current release, SCOPe 2.08
View in 3D