SCOP 1.65: Domain d1f97a2: 1f97 A:129-238

Lineage for d1f97a2 (1f97 A:129-238)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (29 proteins)

6. Protein Junction adhesion molecule, JAM, C-terminal domain [49186] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49187] (1 PDB entry)

8. Domain d1f97a2: 1f97 A:129-238 [21764]
   Other proteins in same PDB: d1f97a1
   complexed with mg

Details for d1f97a2

PDB Entry: 1f97, 2.5 Å

PDB Description: soluble part of the junction adhesion molecule from mouse

SCOP Domain Sequences for d1f97a2:

Sequence, based on SEQRES records:

>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus)}
vppskptisvpssvtignravltcsehdgsppseyswfkdgismltadakktrafmnssf
tidpksgdlifdpvtafdsgeyycqaqngygtamrseaahmdavelnvgg

Sequence, based on observed residues (ATOM records):

>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus)}
vppskptisvpssvtignravltcsehdgsppseyswfkdgismlttrafmnssftidpk
sgdlifdpvtafdsgeyycqaqngygtamrseaahmdavelnvgg

Timeline for d1f97a2:

• d1f97a2 first appeared (with stable ids) in SCOP 1.55
  
• d1f97a2 appears in SCOP 1.63
  
• d1f97a2 appears in SCOP 1.67
  
• d1f97a2 appears in the current release, SCOPe 2.08