Lineage for d1f97a2 (1f97 A:129-238)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753795Protein Junction adhesion molecule, JAM, C-terminal domain [49186] (2 species)
  7. 2753799Species Mouse (Mus musculus) [TaxId:10090] [49187] (1 PDB entry)
  8. 2753800Domain d1f97a2: 1f97 A:129-238 [21764]
    Other proteins in same PDB: d1f97a1
    complexed with mg

Details for d1f97a2

PDB Entry: 1f97 (more details), 2.5 Å

PDB Description: soluble part of the junction adhesion molecule from mouse
PDB Compounds: (A:) junction adhesion molecule

SCOPe Domain Sequences for d1f97a2:

Sequence, based on SEQRES records: (download)

>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
vppskptisvpssvtignravltcsehdgsppseyswfkdgismltadakktrafmnssf
tidpksgdlifdpvtafdsgeyycqaqngygtamrseaahmdavelnvgg

Sequence, based on observed residues (ATOM records): (download)

>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
vppskptisvpssvtignravltcsehdgsppseyswfkdgismlttrafmnssftidpk
sgdlifdpvtafdsgeyycqaqngygtamrseaahmdavelnvgg

SCOPe Domain Coordinates for d1f97a2:

Click to download the PDB-style file with coordinates for d1f97a2.
(The format of our PDB-style files is described here.)

Timeline for d1f97a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f97a1