Lineage for d1cs6a2 (1cs6 A:104-208)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787056Protein Axonin-1 [49184] (1 species)
    tandem repeat of 4 L1 domains
  7. 787057Species Chicken (Gallus gallus) [TaxId:9031] [49185] (1 PDB entry)
  8. 787059Domain d1cs6a2: 1cs6 A:104-208 [21761]

Details for d1cs6a2

PDB Entry: 1cs6 (more details), 1.8 Å

PDB Description: n-terminal fragment of axonin-1 from chicken
PDB Compounds: (A:) axonin-1

SCOP Domain Sequences for d1cs6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]}
gflqefsaeerdpvkitegwgvmftcsppphypalsyrwllnefpnfipadgrrfvsqtt
gnlyiakteasdlgnyscfatshidfitksvfskfsqlslaaeda

SCOP Domain Coordinates for d1cs6a2:

Click to download the PDB-style file with coordinates for d1cs6a2.
(The format of our PDB-style files is described here.)

Timeline for d1cs6a2: