Lineage for d3v1wa1 (3v1w A:2-126)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484517Family c.47.1.3: Calsequestrin [52855] (1 protein)
    duplication: contains three tandem repeats of this fold
  6. 2484518Protein Calsequestrin [52856] (1 species)
  7. 2484519Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52857] (3 PDB entries)
  8. 2484523Domain d3v1wa1: 3v1w A:2-126 [217597]
    automated match to d1a8ya1
    complexed with ca, mpd, mrd, na

Details for d3v1wa1

PDB Entry: 3v1w (more details), 1.91 Å

PDB Description: molecular basis for multiple ligand binding of calsequestrin and potential inhibition by caffeine and gallocatecin
PDB Compounds: (A:) Calsequestrin-1

SCOPe Domain Sequences for d3v1wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v1wa1 c.47.1.3 (A:2-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
egldfpeydgvdrvinvnaknyknvfkkyevlallyheppeddkasqrqfemeelilela
aqvledkgvgfglvdsekdaavakklglteedsiyvfkedevieydgefsadtlveflld
vledp

SCOPe Domain Coordinates for d3v1wa1:

Click to download the PDB-style file with coordinates for d3v1wa1.
(The format of our PDB-style files is described here.)

Timeline for d3v1wa1: