Class a: All alpha proteins [46456] (285 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (15 PDB entries) |
Domain d3uxnb1: 3uxn B:10-91 [217567] Other proteins in same PDB: d3uxna2, d3uxna3, d3uxnb2, d3uxnb3 automated match to d1huza1 |
PDB Entry: 3uxn (more details), 2.5 Å
SCOPe Domain Sequences for d3uxnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uxnb1 a.60.6.1 (B:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki aekideflatgklrklekirqd
Timeline for d3uxnb1: