Lineage for d3uxmc_ (3uxm C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480760Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226294] (12 PDB entries)
  8. 2480776Domain d3uxmc_: 3uxm C: [217562]
    automated match to d3hjnb_
    complexed with 0dn, mg

Details for d3uxmc_

PDB Entry: 3uxm (more details), 1.95 Å

PDB Description: Structure Guided Development of Novel Thymidine Mimetics targeting Pseudomonas aeruginosa Thymidylate Kinase: from Hit to Lead Generation
PDB Compounds: (C:) thymidylate kinase

SCOPe Domain Sequences for d3uxmc_:

Sequence, based on SEQRES records: (download)

>d3uxmc_ c.37.1.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
fvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqapery
qvldaglplaevqagldrllpnllerl

Sequence, based on observed residues (ATOM records): (download)

>d3uxmc_ c.37.1.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tglfvtlegpegatnrdylaerlrergievqltrepggtplaerirelllapsdepmaad
telllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesfvq
gdlrpdltlvfdlpveiglaraaldrfeqedrrffeavrqtylqraaqaperyqvldagl
plaevqagldrllpnllerl

SCOPe Domain Coordinates for d3uxmc_:

Click to download the PDB-style file with coordinates for d3uxmc_.
(The format of our PDB-style files is described here.)

Timeline for d3uxmc_: