SCOPe 2.08: Domain d3uejb1: 3uej B:231-280

Lineage for d3uejb1 (3uej B:231-280)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (4 families)

5. Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
   Pfam PF00130

6. Protein automated matches [193184] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries)

8. Domain d3uejb1: 3uej B:231-280 [217327]
   Other proteins in same PDB: d3ueja2, d3ueja3, d3uejb2, d3uejb3
   automated match to d3ugib_
   complexed with po4, zn

Details for d3uejb1

PDB Entry: 3uej, 1.3 Å

PDB Description: structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta

PDB Compounds: (B:) protein kinase c delta type

SCOPe Domain Sequences for d3uejb1:

Sequence; same for both SEQRES and ATOM records:

>d3uejb1 g.49.1.1 (B:231-280) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc

Timeline for d3uejb1:

• d3uejb1 first appeared in SCOPe 2.03, called d3uejb_
  
• d3uejb1 appears in SCOPe 2.07