SCOPe 2.03: Domain d3ucdb2: 3ucd B:140-432

Lineage for d3ucdb2 (3ucd B:140-432)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (2 proteins)
   automatically mapped to Pfam PF00113

6. Protein Enolase [51606] (9 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (9 PDB entries)
   Uniprot P09104

8. Domain d3ucdb2: 3ucd B:140-432 [217289]
   Other proteins in same PDB: d3ucda1, d3ucdb1
   automated match to d1pdza1
   complexed with 2pg, mg, pep

Details for d3ucdb2

PDB Entry: 3ucd, 1.41 Å

PDB Description: asymmetric complex of human neuron specific enolase-2-pga/pep

PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d3ucdb2:

Sequence; same for both SEQRES and ATOM records:

>d3ucdb2 c.1.11.1 (B:140-432) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsv

Timeline for d3ucdb2:

• d3ucdb2 is new in SCOPe 2.03-stable
  
• d3ucdb2 appears in SCOPe 2.04
  
• d3ucdb2 appears in the current release, SCOPe 2.08