Lineage for d3ucdb1 (3ucd B:1-139)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412715Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1412760Protein Enolase [54828] (9 species)
  7. 1412804Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (9 PDB entries)
    Uniprot P09104
  8. 1412808Domain d3ucdb1: 3ucd B:1-139 [217288]
    Other proteins in same PDB: d3ucda2, d3ucdb2
    automated match to d1pdza2
    complexed with 2pg, mg, pep

Details for d3ucdb1

PDB Entry: 3ucd (more details), 1.41 Å

PDB Description: asymmetric complex of human neuron specific enolase-2-pga/pep
PDB Compounds: (B:) Gamma-enolase

SCOPe Domain Sequences for d3ucdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ucdb1 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siqkiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

SCOPe Domain Coordinates for d3ucdb1:

Click to download the PDB-style file with coordinates for d3ucdb1.
(The format of our PDB-style files is described here.)

Timeline for d3ucdb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ucdb2