SCOPe 2.08: Domain d3ucbb_: 3ucb B:

Lineage for d3ucbb_ (3ucb B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (590 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d3ucbb_: 3ucb B: [217281]
   automated match to d4j5ja_
   complexed with 017

Details for d3ucbb_

PDB Entry: 3ucb, 1.38 Å

PDB Description: Crystal Structure of Multidrug Resistant HIV-1 Protease Clinical Isolate PR20 in Complex with Darunavir

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3ucbb_:

Sequence; same for both SEQRES and ATOM records:

>d3ucbb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrpfvtvkvggqlkealldtgadntifedinlpgrwkpkmvggiggflkvreyd
qvpieiaghkvigtvlvgptpvnvigrdtmtqigatlnf

Timeline for d3ucbb_:

• d3ucbb_ first appeared in SCOPe 2.03
  
• d3ucbb_ appears in SCOPe 2.07