Lineage for d1cvsc1 (1cvs C:149-250)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 550483Family b.1.1.4: I set domains [49159] (34 proteins)
  6. 550543Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 550544Species Human (Homo sapiens), FGFR1 [TaxId:9606] [49180] (3 PDB entries)
  8. 550545Domain d1cvsc1: 1cvs C:149-250 [21726]
    Other proteins in same PDB: d1cvsa_, d1cvsb_

Details for d1cvsc1

PDB Entry: 1cvs (more details), 2.8 Å

PDB Description: crystal structure of a dimeric fgf2-fgfr1 complex

SCOP Domain Sequences for d1cvsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvsc1 b.1.1.4 (C:149-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1}
mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv
ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvver

SCOP Domain Coordinates for d1cvsc1:

Click to download the PDB-style file with coordinates for d1cvsc1.
(The format of our PDB-style files is described here.)

Timeline for d1cvsc1: