Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
Domain d1cvsc1: 1cvs C:149-250 [21726] Other proteins in same PDB: d1cvsa_, d1cvsb_ complexed with so4 |
PDB Entry: 1cvs (more details), 2.8 Å
SCOPe Domain Sequences for d1cvsc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cvsc1 b.1.1.4 (C:149-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} mpvapywtspekmekklhavpaaktvkfkcpssgtpqptlrwlkngkefkpdhriggykv ryatwsiimdsvvpsdkgnytciveneygsinhtyqldvver
Timeline for d1cvsc1:
View in 3D Domains from other chains: (mouse over for more information) d1cvsa_, d1cvsb_, d1cvsd1, d1cvsd2 |