SCOPe 2.05: Domain d3u9xa_: 3u9x A:

Lineage for d3u9xa_ (3u9x A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (38 PDB entries)

8. Domain d3u9xa_: 3u9x A: [217258]
   automated match to d3p1oa_
   complexed with cl, gol, mg

Details for d3u9xa_

PDB Entry: 3u9x, 1.8 Å

PDB Description: Covalent attachment of pyridoxal-phosphate derivatives to 14-3-3 proteins

PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d3u9xa_:

Sequence, based on SEQRES records:

>d3u9xa_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqr
aawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaes
rvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnf
svfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records):

>d3u9xa_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqr
aawrvlssieqksngpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkm
kgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyei
anspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Timeline for d3u9xa_:

• d3u9xa_ first appeared in SCOPe 2.03
  
• d3u9xa_ appears in SCOPe 2.04
  
• d3u9xa_ is called d3u9xa1 in SCOPe 2.06
  
• d3u9xa_ appears in the current release, SCOPe 2.08, called d3u9xa1