Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein automated matches [190252] (5 species) not a true protein |
Species Yersinia enterocolitica [TaxId:630] [226454] (1 PDB entry) |
Domain d3u96b_: 3u96 B: [217249] automated match to d1lyva_ complexed with csn, so4 |
PDB Entry: 3u96 (more details), 1.8 Å
SCOPe Domain Sequences for d3u96b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u96b_ c.45.1.2 (B:) automated matches {Yersinia enterocolitica [TaxId: 630]} spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdftavssevtk alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns
Timeline for d3u96b_: