SCOPe 2.07: Domain d3u96b_: 3u96 B:

Lineage for d3u96b_ (3u96 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (5 species)
   not a true protein

7. Species Yersinia enterocolitica [TaxId:630] [226454] (1 PDB entry)

8. Domain d3u96b_: 3u96 B: [217249]
   automated match to d1lyva_
   complexed with csn, so4

Details for d3u96b_

PDB Entry: 3u96, 1.8 Å

PDB Description: crystal structure of yophq357f(catalytic domain, residues 163-468) in complex with pncs

PDB Compounds: (B:) Tyrosine-protein phosphatase yopH

SCOPe Domain Sequences for d3u96b_:

Sequence; same for both SEQRES and ATOM records:

>d3u96b_ c.45.1.2 (B:) automated matches {Yersinia enterocolitica [TaxId: 630]}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnwpdftavssevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

Timeline for d3u96b_:

• d3u96b_ first appeared in SCOPe 2.03
  
• d3u96b_ appears in SCOPe 2.06
  
• d3u96b_ appears in the current release, SCOPe 2.08