Lineage for d3u95b2 (3u95 B:192-469)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233076Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins)
    family 4 glycosyl hydrolase
    automatically mapped to Pfam PF11975
  6. 2233116Protein automated matches [227094] (3 species)
    not a true protein
  7. 2233127Species Thermotoga neapolitana [TaxId:309803] [226486] (1 PDB entry)
  8. 2233129Domain d3u95b2: 3u95 B:192-469 [217239]
    Other proteins in same PDB: d3u95a1, d3u95b1, d3u95c1, d3u95d1, d3u95e1, d3u95f1
    automated match to d1vjta2
    complexed with mn

Details for d3u95b2

PDB Entry: 3u95 (more details), 2 Å

PDB Description: Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana
PDB Compounds: (B:) Glycoside hydrolase, family 4

SCOPe Domain Sequences for d3u95b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u95b2 d.162.1.2 (B:192-469) automated matches {Thermotoga neapolitana [TaxId: 309803]}
erlgldpeevdwqvagvnhgiwlnrfryrgkdayplldewiekelskwepknpwdtqmsp
aamdmyrfygmlpigdtvrngtwkyhynletkkkwfrrfggidneverpkfhehlrrare
rliklaeevqenphlkitekhpeifpkgrlsgeqhipfinaiannkrvrlflnvenqgal
kdfpddlvmelpvwvdssgihrekvepdlthrikifylwprilrtewnleafisrdrkvl
eeilirdprtksyeqvvkvldeilslpfneeirryyen

SCOPe Domain Coordinates for d3u95b2:

Click to download the PDB-style file with coordinates for d3u95b2.
(The format of our PDB-style files is described here.)

Timeline for d3u95b2: