Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins) family 4 glycosyl hydrolase automatically mapped to Pfam PF11975 |
Protein automated matches [227094] (3 species) not a true protein |
Species Thermotoga neapolitana [TaxId:309803] [226486] (1 PDB entry) |
Domain d3u95b2: 3u95 B:192-469 [217239] Other proteins in same PDB: d3u95a1, d3u95b1, d3u95c1, d3u95d1, d3u95e1, d3u95f1 automated match to d1vjta2 complexed with mn |
PDB Entry: 3u95 (more details), 2 Å
SCOPe Domain Sequences for d3u95b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u95b2 d.162.1.2 (B:192-469) automated matches {Thermotoga neapolitana [TaxId: 309803]} erlgldpeevdwqvagvnhgiwlnrfryrgkdayplldewiekelskwepknpwdtqmsp aamdmyrfygmlpigdtvrngtwkyhynletkkkwfrrfggidneverpkfhehlrrare rliklaeevqenphlkitekhpeifpkgrlsgeqhipfinaiannkrvrlflnvenqgal kdfpddlvmelpvwvdssgihrekvepdlthrikifylwprilrtewnleafisrdrkvl eeilirdprtksyeqvvkvldeilslpfneeirryyen
Timeline for d3u95b2: