Lineage for d3u94d1 (3u94 D:3-255)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523133Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2523251Domain d3u94d1: 3u94 D:3-255 [217235]
    Other proteins in same PDB: d3u94d2
    automated match to d3u93b_
    complexed with cl, glu, so4, zn

Details for d3u94d1

PDB Entry: 3u94 (more details), 1.96 Å

PDB Description: crystal structure of the gluk3 ligand binding domain complex with glutamate and zinc: p21212 form
PDB Compounds: (D:) Glutamate receptor, ionotropic kainate 3

SCOPe Domain Sequences for d3u94d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u94d1 c.94.1.0 (D:3-255) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgkyg
aqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpids
addlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtlta
dyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeedkl
himkekwwrgsgc

SCOPe Domain Coordinates for d3u94d1:

Click to download the PDB-style file with coordinates for d3u94d1.
(The format of our PDB-style files is described here.)

Timeline for d3u94d1: