Lineage for d3u92b_ (3u92 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523133Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2523233Domain d3u92b_: 3u92 B: [217231]
    automated match to d3u93b_
    complexed with cl, kai, zn

Details for d3u92b_

PDB Entry: 3u92 (more details), 1.9 Å

PDB Description: crystal structure of the gluk3 ligand binding domain complex with kainate and zinc: p2221 form
PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 3

SCOPe Domain Sequences for d3u92b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u92b_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgkyg
aqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpids
addlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtlta
dyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeedkl
himkekwwrgsgcp

SCOPe Domain Coordinates for d3u92b_:

Click to download the PDB-style file with coordinates for d3u92b_.
(The format of our PDB-style files is described here.)

Timeline for d3u92b_: