Lineage for d3u8uc_ (3u8u C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594378Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2594379Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2594380Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2594403Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 2594404Species Human (Homo sapiens) [TaxId:9606] [56224] (15 PDB entries)
  8. 2594414Domain d3u8uc_: 3u8u C: [217222]
    automated match to d1hd7a_
    complexed with cl, mg

Details for d3u8uc_

PDB Entry: 3u8u (more details), 2.15 Å

PDB Description: Crystal structure of Human Apurinic/Apyridinimic Endonuclease, Ape1 in a new crystal form
PDB Compounds: (C:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d3u8uc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u8uc_ d.151.1.1 (C:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
yfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d3u8uc_:

Click to download the PDB-style file with coordinates for d3u8uc_.
(The format of our PDB-style files is described here.)

Timeline for d3u8uc_: