| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
| Protein automated matches [190158] (18 species) not a true protein |
| Species Paracoccus denitrificans [TaxId:318586] [226510] (1 PDB entry) |
| Domain d3u7rb_: 3u7r B: [217215] automated match to d1t0ib_ complexed with 2pe, fnr |
PDB Entry: 3u7r (more details), 1.4 Å
SCOPe Domain Sequences for d3u7rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u7rb_ c.23.5.0 (B:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
vktvavmvgslrkdslnhklmkvlqklaegrlefhllhigdlphynddlwadapesvlrl
kdriehsdavlaitpeynrsypgmiknaidwatrpygqnswkgkpaavigtspgvigaal
aqarlkndllhvgtvmmsmpeayiqwhaeayaadgsvtdektakflqgfvdafvdwiekh
gl
Timeline for d3u7rb_: