SCOPe 2.03: Domain d3u4la1: 3u4l A:6-146

Lineage for d3u4la1 (3u4l A:6-146)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226802] (2 PDB entries)

8. Domain d3u4la1: 3u4l A:6-146 [217193]
   Other proteins in same PDB: d3u4la2, d3u4lp_
   automated match to d1d4xa1
   complexed with atp, ca

Details for d3u4la1

PDB Entry: 3u4l, 2.4 Å

PDB Description: Cryocooled bovine profilin:actin crystal structure to 2.4 A

PDB Compounds: (A:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d3u4la1:

Sequence, based on SEQRES records:

>d3u4la1 c.55.1.0 (A:6-146) automated matches {Cow (Bos taurus) [TaxId: 9913]}
aalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfe
tfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d3u4la1 c.55.1.0 (A:6-146) automated matches {Cow (Bos taurus) [TaxId: 9913]}
aalvvdngsgmckagfagddapravfpsivgdsyvgdeaqskrgikypiehgivtnwddm
ekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamyvaiqavlsl
yasg

Timeline for d3u4la1:

• d3u4la1 is new in SCOPe 2.03-stable
  
• d3u4la1 appears in SCOPe 2.04
  
• d3u4la1 appears in the current release, SCOPe 2.08