Lineage for d3u4la1 (3u4l A:6-146)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [226802] (2 PDB entries)
  8. 1373397Domain d3u4la1: 3u4l A:6-146 [217193]
    Other proteins in same PDB: d3u4la2, d3u4lp_
    automated match to d1d4xa1
    complexed with atp, ca

Details for d3u4la1

PDB Entry: 3u4l (more details), 2.4 Å

PDB Description: Cryocooled bovine profilin:actin crystal structure to 2.4 A
PDB Compounds: (A:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d3u4la1:

Sequence, based on SEQRES records: (download)

>d3u4la1 c.55.1.0 (A:6-146) automated matches {Cow (Bos taurus) [TaxId: 9913]}
aalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfe
tfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d3u4la1 c.55.1.0 (A:6-146) automated matches {Cow (Bos taurus) [TaxId: 9913]}
aalvvdngsgmckagfagddapravfpsivgdsyvgdeaqskrgikypiehgivtnwddm
ekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamyvaiqavlsl
yasg

SCOPe Domain Coordinates for d3u4la1:

Click to download the PDB-style file with coordinates for d3u4la1.
(The format of our PDB-style files is described here.)

Timeline for d3u4la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3u4la2
View in 3D
Domains from other chains:
(mouse over for more information)
d3u4lp_