SCOPe 2.07: Domain d3u3kb_: 3u3k B:

Lineage for d3u3kb_ (3u3k B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)

8. Domain d3u3kb_: 3u3k B: [217171]
   automated match to d2z5fa_
   complexed with 03v, a3p

Details for d3u3kb_

PDB Entry: 3u3k, 2.36 Å

PDB Description: Crystal structure of hSULT1A1 bound to PAP and 2-Naphtol

PDB Compounds: (B:) Sulfotransferase 1A1

SCOPe Domain Sequences for d3u3kb_:

Sequence; same for both SEQRES and ATOM records:

>d3u3kb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
ekchrapifmrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
varnakdvavsyyhfyhmakvhpepgtwdsflekfmvgevsygswyqhvqewwelsrthp
vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttvpqef
mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel

Timeline for d3u3kb_:

• d3u3kb_ first appeared in SCOPe 2.03
  
• d3u3kb_ appears in SCOPe 2.06
  
• d3u3kb_ appears in the current release, SCOPe 2.08