![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Type-1 interleukin-1 receptor [49177] (1 species) duplication: tandem repeat of 3 domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49178] (4 PDB entries) |
![]() | Domain d1iray1: 1ira Y:1-101 [21717] Other proteins in same PDB: d1irax_ complexed with nag |
PDB Entry: 1ira (more details), 2.7 Å
SCOPe Domain Sequences for d1iray1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} dkckereekiilvssaneidvrpcplnpnehkgtitwykddsktpvsteqasrihqhkek lwfvpakvedsghyycvvrnssyclrikisakfvenepnlc
Timeline for d1iray1: