SCOPe 2.06: Domain d3u2sb1: 3u2s B:2-107

Lineage for d3u2sb1 (3u2s B:2-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3u2sb1: 3u2s B:2-107 [217158]
   Other proteins in same PDB: d3u2sb2, d3u2sl2
   automated match to d1aqkl1
   complexed with bu3, nag, so4

Details for d3u2sb1

PDB Entry: 3u2s, 1.8 Å

PDB Description: crystal structure of pg9 fab in complex with v1v2 region from hiv-1 strain zm109

PDB Compounds: (B:) PG9 light chain

SCOPe Domain Sequences for d3u2sb1:

Sequence; same for both SEQRES and ATOM records:

>d3u2sb1 b.1.1.0 (B:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqpasvsgspgqsitiscqgtsndvggyesvswyqqhpgkapkvviydvskrpsgvs
nrfsgsksgntasltisglqaedegdyycksltstrrrvfgtgtkltvlg

Timeline for d3u2sb1:

• d3u2sb1 first appeared in SCOPe 2.03
  
• d3u2sb1 appears in SCOPe 2.05
  
• d3u2sb1 appears in SCOPe 2.07
  
• d3u2sb1 appears in the current release, SCOPe 2.08