SCOP 1.73: Domain d1wita_: 1wit A:

Lineage for d1wita_ (1wit A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (36 proteins)

6. Protein Twitchin [49174] (2 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [49175] (3 PDB entries)
   different modules

8. Domain d1wita_: 1wit A: [21714]

Details for d1wita_

PDB Entry: 1wit

PDB Description: twitchin immunoglobulin superfamily domain (igsf module) (ig 18'), nmr, minimized average structure

PDB Compounds: (A:) twitchin 18th igsf module

SCOP Domain Sequences for d1wita_:

Sequence; same for both SEQRES and ATOM records:

>d1wita_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
lkpkiltasrkikikagfthnlevdfigapdptatwtvgdsgaalapellvdakssttsi
ffpsakradsgnyklkvknelgedeaifevivq

Timeline for d1wita_:

• d1wita_ first appeared (with stable ids) in SCOP 1.55, called d1wit__
  
• d1wita_ was called d1wit__ in SCOP 1.71
  
• d1wita_ appears in SCOP 1.75
  
• d1wita_ appears in the current release, SCOPe 2.08