Lineage for d1wita_ (1wit A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.4: I set domains [49159] (39 proteins)
  6. Protein Twitchin [49174] (2 species)
  7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [49175] (3 PDB entries)
    different modules
  8. Domain d1wita_: 1wit A: [21714]

Details for d1wita_

PDB Entry: 1wit (more details)

PDB Description: twitchin immunoglobulin superfamily domain (igsf module) (ig 18'), nmr, minimized average structure
PDB Compounds: (A:) twitchin 18th igsf module

SCOPe Domain Sequences for d1wita_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wita_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
lkpkiltasrkikikagfthnlevdfigapdptatwtvgdsgaalapellvdakssttsi
ffpsakradsgnyklkvknelgedeaifevivq

SCOPe Domain Coordinates for d1wita_ are not available.

Timeline for d1wita_: